Protein Info for BPHYT_RS24345 in Burkholderia phytofirmans PsJN

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 24 to 41 (18 residues), see Phobius details PF00890: FAD_binding_2" amino acids 23 to 65 (43 residues), 22.9 bits, see alignment 9.7e-09 PF01266: DAO" amino acids 23 to 416 (394 residues), 252.5 bits, see alignment E=1.8e-78 PF13450: NAD_binding_8" amino acids 26 to 58 (33 residues), 30.3 bits, see alignment (E = 8.3e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4903)

Predicted SEED Role

"Sarcosine oxidase beta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TC47 at UniProt or InterPro

Protein Sequence (446 amino acids)

>BPHYT_RS24345 FAD-dependent oxidoreductase (Burkholderia phytofirmans PsJN)
MTTTYPLHANFTSADQAFPKHADVVIAGAGIMGCAAAYYLARRGLSVVVLDKSRIAGQQS
SRAWGFVRQQGRESAEVPLMMAAIPLWKQLESELNFDLEWRQGGCLYVATGEEDWASFQQ
WMDVARQHGLDTRTLDRKQIDTVVTGMHAPALGGLYTPSDGQAEPRRAAAAFAARAREAG
ALFFEGCGVIGVERAGGAIAGVVTERGTLRTSRFICAAGASSWRLLKTLGLELPQQAVRG
TCMRTNPLPRITASTFWGHGLGVRQRANGAINLADDMQVDVDMTLGHFRALKWFLPELWA
QREKFSFHLNGASLRDLRERLPGGVPKHERVLHPRDPHPQPNAGHAPRALKKLRALFPAL
KDAQVVESWAGLIDVLPDGIPVIDAPPQVSGLTIATGFCGHGFAMGPIVGKLLAEMNDGG
EASLDLSAFRLQRFFDGTMQRPRSML