Protein Info for BPHYT_RS24335 in Burkholderia phytofirmans PsJN

Annotation: toxin HipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF13657: Couple_hipA" amino acids 10 to 111 (102 residues), 89.2 bits, see alignment E=2.3e-29 TIGR03071: HipA N-terminal domain" amino acids 10 to 111 (102 residues), 88.8 bits, see alignment E=1.1e-29 PF07804: HipA_C" amino acids 158 to 406 (249 residues), 173 bits, see alignment E=7e-55

Best Hits

KEGG orthology group: K07154, (no description) (inferred from 100% identity to bpy:Bphyt_4901)

Predicted SEED Role

"HipA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TC45 at UniProt or InterPro

Protein Sequence (446 amino acids)

>BPHYT_RS24335 toxin HipA (Burkholderia phytofirmans PsJN)
MGRQTHSRALSVWANGERVGVWRLPARGPMELAYDPAWVASPAGRPLSLSLPFTPGNLAQ
KGPRVLNYFDNLLPDSEAIRKRIAQRYQTETLDAFDLLQAIGRDCVGAVQLLAEDDVPQG
VEQIEGTPLTDSEIETMLARTVGNPALGAPDQTDDFRISLAGAQEKTALLWHDGKWQRPH
GATPTTHIFKLPLGLVGNKLADLSTSVENEWLCLRILRAYGLPVANTEIMTFGKQRVLSV
ERFDRQMHSSGQWLLRLPQEDFCQVYGVPSHRKYENEGGPGVLDLARILQQSVEARQDIE
TLLASQILFWMLAAPDGHAKNFSIRLLAGGHYRLTPLYDVMSIWPVEGSGPNQWSWFKAR
LAMGMWSRSKHDAFRDVQRRHFNTMALKCSYGADAEPLIQRLIEQTPGVIERVSAELPER
FPAKVAERIFKGLKNSAAKLGTMSAG