Protein Info for BPHYT_RS24265 in Burkholderia phytofirmans PsJN

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 122 to 139 (18 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00892: EamA" amino acids 6 to 135 (130 residues), 54.2 bits, see alignment E=9e-19 amino acids 148 to 278 (131 residues), 50.8 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 70% identical to YDEK_BACSU: Uncharacterized transporter YdeK (ydeK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4886)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TC30 at UniProt or InterPro

Protein Sequence (295 amino acids)

>BPHYT_RS24265 transporter (Burkholderia phytofirmans PsJN)
MDKTTNGWLSGFIGVLIFSGSLPATRVAVQGLDPLFLTVARATIAGTLGLLLLLVFRQAR
PSRRDLMPLAIVALGVVIGFPLLTALALRHVSAAHAVVFVGLLPLATAIFGVLRGGERPQ
PAFWLFSALGSGAVVAFALRHGLEASPIGDALMLAAIVACGLGYAEGALLSRHLGGWQVI
SWALVLSLPLMLPLAVWTRPVSFDGVSQASLWGLAYVSLFSMLIGFMFWYRGLALGGIAG
VGQLQLLQPFFGLLLAGLLLHEQVPPAMILVTVVVVGCVAGARHFSRAAPVRPAV