Protein Info for BPHYT_RS24185 in Burkholderia phytofirmans PsJN

Annotation: C4-dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 92 to 105 (14 residues), see Phobius details amino acids 144 to 149 (6 residues), see Phobius details amino acids 155 to 161 (7 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 226 to 254 (29 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 332 to 357 (26 residues), see Phobius details amino acids 362 to 390 (29 residues), see Phobius details amino acids 417 to 440 (24 residues), see Phobius details PF06808: DctM" amino acids 8 to 435 (428 residues), 343.5 bits, see alignment E=8.4e-107 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 441 (425 residues), 370.6 bits, see alignment E=4.3e-115

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4870)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TC15 at UniProt or InterPro

Protein Sequence (450 amino acids)

>BPHYT_RS24185 C4-dicarboxylate ABC transporter permease (Burkholderia phytofirmans PsJN)
MELAILSVSFLVFLLLGVPVSFGLGLACVLTYLYEGLPAATAMQSMISGINGFSFLAVPF
FILSGELMLHGGIADRILRFAQATVGHFRGGLGMANVVACTLFGGVSGSPSADTSAMGGV
VIPLMKREGYSAAYAVNVTTHSSLAGALMPTSTNMIIYAFAAQGITGTLNGHPMSGVSIG
DLLFSGLLPVLWVMGFVLIAAYWQAVKYGYPRRADGSTELQKFPGWYAVARTFLGALPGL
MVIAIILVCVAKGIATATEAAAIAVFYSLVLTIVVYRSMTMKKLFHALSKAAKTTGVVLL
LIGVSNMLRYQMAYLEIPDAIEHMLDGATSLPWLMLLYINLIQIFLGTFVDMAAHILITT
PLFLPMAMHAGVGPVQFGIMILLNCALGLVHPPIGSVQFIGCAIGNVSIGETTKVAWPYY
LAIFSAINIVTYVPMFSTWLPSLINGHPVF