Protein Info for BPHYT_RS24165 in Burkholderia phytofirmans PsJN

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 17 to 162 (146 residues), 30.7 bits, E=6.1e-11
• PF01370: Epimerase
  • amino acids 19 to 176 (158 residues), 76.3 bits, E=9.2e-25
• PF01073: 3Beta_HSD
  • amino acids 20 to 129 (110 residues), 45 bits, E=2.7e-15
• PF13460: NAD_binding_10
  • amino acids 22 to 126 (105 residues), 30.5 bits, E=1.2e-10
• PF02719: Polysacc_synt_2
  • amino acids 57 to 127 (71 residues), 23 bits, E=1.5e-08
• PF16363: GDP_Man_Dehyd
  • amino acids 59 to 183 (125 residues), 42.8 bits, E=1.7e-14
• PF07993: NAD_binding_4
  • amino acids 67 to 184 (118 residues), 24.5 bits, E=5e-09

Best Hits

Swiss-Prot: 55% identical to URODH_PSEPK: Uronate dehydrogenase (udh) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4866)

MetaCyc: 52% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• D-glucuronate degradation III (2/2 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• D-glucuronate degradation II (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• D-galacturonate degradation III (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galacturonate degradation II (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (20/31 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

See B2TC11 at UniProt or InterPro

Protein Sequence (280 amino acids)

>BPHYT_RS24165 NAD-dependent dehydratase (Burkholderia phytofirmans PsJN)
MTDSNLDRSAAQKPFRRLLLTGAAGNLGKQLRGALAAWADIVRITDIAPLGEVAAHEEAS
IVDIADEAAVHALLEGVDAVVHLGGISVEAPFEDLLQANIRGLYNLYSAAQKQGVKRIVY
ASSNHAVGFHPVTEVVDIDAPLRPDSLYGVTKCFGESLSRYYFDRFGLETVCLRIGSSFE
QPKNPRMLVTYLSFRDLIELVRCSLFTNRVGHAIVYGVSDNRTKWVDNTKAAFLGFRPQD
SSVEFEHLFPVTAPTADLDDPTQRFQGGPFVLAGPMEPKR