Protein Info for BPHYT_RS24135 in Burkholderia phytofirmans PsJN

Annotation: alpha-dehydro-beta-deoxy-D-glucarate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03239: 2-dehydro-3-deoxyglucarate aldolase
  • amino acids 12 to 259 (248 residues), 410.8 bits, E=1.1e-127
• PF03328: HpcH_HpaI
  • amino acids 25 to 247 (223 residues), 182 bits, E=5.1e-58

Best Hits

Swiss-Prot: 64% identical to GARL_ENT38: 5-keto-4-deoxy-D-glucarate aldolase (garL) from Enterobacter sp. (strain 638)

KEGG orthology group: K01630, 2-dehydro-3-deoxyglucarate aldolase [EC: 4.1.2.20] (inferred from 100% identity to bpy:Bphyt_4860)

MetaCyc: 61% identical to alpha-dehydro-beta-deoxy-D-glucarate aldolase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxyglucarate aldolase. [EC: 4.1.2.20]

Predicted SEED Role

"2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.1.2.20)

MetaCyc Pathways

• superpathway of D-glucarate and D-galactarate degradation (4/5 steps found)
• D-glucarate degradation I (3/4 steps found)
• D-galactarate degradation I (3/4 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (20/31 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.20

Use Curated BLAST to search for 4.1.2.20

Sequence Analysis Tools

See B2TC05 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BPHYT_RS24135 alpha-dehydro-beta-deoxy-D-glucarate aldolase (Burkholderia phytofirmans PsJN)
MPAITPYQPLPNSFRRAVCGGETLIGCWASLASPIVTELLGIVGFDWMLLDAEHAPNDVL
TLIPQLMALKDSASAPVVRPPANDSVFIKRLLDSGFSNFLVPFVESADDAARAVAATRYP
PQGIRGVSVSHRGNHYATVPDYFSVANDNVCVIVQIESRKAVDAIDEILAVDGVDAVFVG
PSDLAAAYGQLGNANHSDVQAAIAHVFERAQAAGKPSGILAPVQADAERYISMGCRVVAV
CADMGLLKGAAQTVQKHFMQKQAGQQ