Protein Info for BPHYT_RS24105 in Burkholderia phytofirmans PsJN

Annotation: chloroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00561: Abhydrolase_1" amino acids 22 to 255 (234 residues), 120.5 bits, see alignment E=2.5e-38 PF12146: Hydrolase_4" amino acids 23 to 255 (233 residues), 85.3 bits, see alignment E=1.1e-27 PF12697: Abhydrolase_6" amino acids 23 to 256 (234 residues), 81.4 bits, see alignment E=3.8e-26

Best Hits

Swiss-Prot: 67% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 100% identity to bpy:Bphyt_4854)

Predicted SEED Role

"Alpha/beta hydrolase fold (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10, 3.8.1.5

Use Curated BLAST to search for 1.11.1.10 or 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBZ5 at UniProt or InterPro

Protein Sequence (273 amino acids)

>BPHYT_RS24105 chloroperoxidase (Burkholderia phytofirmans PsJN)
MSTIKTKDGTSIFYKDWGKGRPVVFSHGWPLSADAWDAQMLFLGSKGFRVIAHDRRGHGR
SEQTWDGNDMDTYADDLAALIEHLDLQDATLVGHSTGGGEVAHYIGRHGTQRVAKAVLIG
AVPPLMLKTESNPNGTPIDVFDGIRKGVEDDRSQFFKDLALPFYGYNRPGAKVSQGVIDS
FWVQGMAGSIKGLYDCVKQFSEVDYTEDLKKIDVPTLVLHGDDDQIVPIDAAGRLTAKIV
KNATLKVYPGGQHGMCTVEAAKVNGDLLEFVGS