Protein Info for BPHYT_RS24070 in Burkholderia phytofirmans PsJN
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4848)Predicted SEED Role
"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
- superpathway of purine nucleotide salvage (12/14 steps found)
- inosine-5'-phosphate biosynthesis I (6/6 steps found)
- inosine-5'-phosphate biosynthesis II (5/5 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
- adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
- inosine-5'-phosphate biosynthesis III (5/6 steps found)
- dZTP biosynthesis (3/5 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Biosynthesis of alkaloids derived from histidine and purine
- Purine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.3.2.2
Use Curated BLAST to search for 4.3.2.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2TBY9 at UniProt or InterPro
Protein Sequence (263 amino acids)
>BPHYT_RS24070 hypothetical protein (Burkholderia phytofirmans PsJN) MGAVPSHAFVRNLDDAILPDLWRRRTRLSGDEMVSMVELVKRALRTYHPLELQALGEDKE ELVAQFIYAKVLRLAPGHTETHACAESAPSNGYALCAYFRRYLIDCLRSAGHQRNVSMEN DGMAQEIDLHAQALEDPVESVLLQYGLDEQRVRLSARAFIESLDEPERIVLAGSLGWCSE GKGGLSAVAAQHRVPSYHYRAVKLGVTMKKTAGAEDFSNTKIGRWLTDVLGIEIEIDNRP AILLALNLLAAESSDSELNEAAA