Protein Info for BPHYT_RS24045 in Burkholderia phytofirmans PsJN

Annotation: amino acid ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 15 to 42 (28 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 108 (98 residues), 87.9 bits, see alignment E=2.7e-29 PF00528: BPD_transp_1" amino acids 35 to 206 (172 residues), 82.5 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 36% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_4843)

MetaCyc: 36% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBK7 at UniProt or InterPro

Protein Sequence (216 amino acids)

>BPHYT_RS24045 amino acid ABC transporter (Burkholderia phytofirmans PsJN)
MFSTTVFLQGLPLLLHAALATIGISLAGLLIGFFVAIGVCAARLSPNRAARMFGGAYVFF
FRGVPMLVQLLLVYYLLPFAGINVSPIVAALSAVSLCSASYIAEILRGGFLSVPPGHLEA
ARMLGLSPFDMLRRILVPQAFRLTLPSLVNEMVLLIKASSLISVVGVAELTRTAQNIAAS
TYRPLEAYVAAGLIYFVICGALALVAHAAEYRLQHA