Protein Info for BPHYT_RS24040 in Burkholderia phytofirmans PsJN

Annotation: amino acid ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 105 (17 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 110 (98 residues), 106.2 bits, see alignment E=5.4e-35 PF00528: BPD_transp_1" amino acids 34 to 201 (168 residues), 75.2 bits, see alignment E=2.8e-25

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_4842)

Predicted SEED Role

"Cystine ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBK6 at UniProt or InterPro

Protein Sequence (220 amino acids)

>BPHYT_RS24040 amino acid ABC transporter (Burkholderia phytofirmans PsJN)
MQQLDPTVITHNLQPIAAGLATTLGTWAAGVAIGILIGFLIAVLQLFCGRWVRGVLRLYI
ELFRGTPFLVQLFLLYYGGPSFGLTLEPMTAGVLGLGLYGSAYFAEAFRSGFQSVPPGHL
EAASCLGLTRWQAVLRIQVPQMLVLIVPALTNLIIVLSKETAVLSIVTVPELTFVLTGIG
SATFAFVETLLVLCVCYLALVELTSRAGMWAETRIARFMA