Protein Info for BPHYT_RS24000 in Burkholderia phytofirmans PsJN

Updated annotation (from data): L-histidine ABC transporter, substrate-binding component
Rationale: Specifically important for histidine utilization.
Original annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00497: SBP_bac_3" amino acids 35 to 281 (247 residues), 176.9 bits, see alignment E=4.3e-56

Best Hits

Swiss-Prot: 44% identical to OCCT_RHIRD: Octopine-binding periplasmic protein (occT) from Rhizobium radiobacter

KEGG orthology group: K10018, octopine/nopaline transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_4834)

Predicted SEED Role

"ABC-type amino acid transport/signal transduction systems, periplasmic component/domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBJ6 at UniProt or InterPro

Protein Sequence (286 amino acids)

>BPHYT_RS24000 L-histidine ABC transporter, substrate-binding component (Burkholderia phytofirmans PsJN)
MKVKRTTAAKTLIGAVLGAAAIFAAPAQAKDWKTVTIALEGGYAPWNLTLPGGKLGGFEP
ELVANLCERIKLQCNLVAQDWDGMIPGLQAGKFDVLMDAISITPEREKIIAFSKPYAATP
ATFAVADAKVLPKAAPGAGVVKLSGDPKADQPTVDALRKQLKGKTIGIQSGTVYTKFIND
GFKDIATIRVYKTSPERDLDLANGRIDASFDDVTYYAANIDKKETASIVMAGPKIGGPIW
GPGEGLAFRKQDADLKAKFDTAISAALADGTVKKLSNKWFKTDVTP