Protein Info for BPHYT_RS23965 in Burkholderia phytofirmans PsJN

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 280 to 307 (28 residues), see Phobius details amino acids 332 to 357 (26 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 400 to 423 (24 residues), see Phobius details amino acids 444 to 469 (26 residues), see Phobius details amino acids 502 to 524 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 252 (165 residues), 52.8 bits, see alignment E=2.1e-18 amino acids 350 to 516 (167 residues), 47.4 bits, see alignment E=9.6e-17

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to bpy:Bphyt_4827)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBI9 at UniProt or InterPro

Protein Sequence (534 amino acids)

>BPHYT_RS23965 iron ABC transporter permease (Burkholderia phytofirmans PsJN)
MSEALSAGPPAVSTVPARARSRAPRGLFAAAALSALLVLLPIAFTFWCAASFGAAEAIDL
IFRPLVGELLINTLTITVSTTLVSAVIGTAAAWFVERTHLPGRRAWAVLSAAPLAMPAFI
SSYAWVSLSQDLQDFTGALLVLTCAYFPLVYLPVAAALRGMDPALEESARALGCNRWTTF
IRVVLPQLRPALLGGMLLVALGVLSEFGAFTLLRFRTFTTQIYAEFRTSFDGGGASLLAC
LLIVICLIVLAFEFRVRGAARYERVDRGTRRAVLRYELGVWRWIVVAGLALLSVTTLGVP
LGMIGYWLTQPGAAAVTPADVSPELLFNATISSLGFGLAAALLTTLLVVPLAFLLVRYPT
RFATLFERTVFLAQGVPGLVIALAIVSLAVHALQPLYQSATLLVIAYSMLFMPLALVSVR
AAFMQAQPRLEETARALGLNWSQTLLRVVLPLAGPGLGAAAAMVFISVVTELNATLLLSP
LDTQTLATQVWADTSTMAFAAAAPYAALLTGISLFASGLLFALLGKSALLGERS