Protein Info for BPHYT_RS23885 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 54 to 85 (32 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 313 (268 residues), 131 bits, see alignment E=2.3e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_4811)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBH3 at UniProt or InterPro

Protein Sequence (365 amino acids)

>BPHYT_RS23885 ABC transporter permease (Burkholderia phytofirmans PsJN)
MRRILEAWAHIVDPRTLPIAVTILLFCALFGFGSVMYTGFFSWQVLLDLLVDNAFLLIVA
IGMTFVIVSGGIDLSVGSVVALTTIVEAVLSEHLHWPVWVILPTVLLMGTVFGAVQGALI
HFFRLQAFIVTLAGMFFARGLCFLITTQSITITDPTFQKISAFRLDIGVGSVTANVLIAF
VTLLAAIYVAHFTRFGRNVYAIGGNARSALLMGLPVAHTRIGVYALSGFCSALGGAVFTF
YVLSGYGLQGQGMELDAIAATVIGGTLLTGGVGYVIGSLFGVGILGTIQTLITFDGTLSS
WWTRIVIGALLCAFCLLQRLIERHAKSVGRPGGTGAVVTAGRERGHADGPAASDSHVIGR
APEQA