Protein Info for BPHYT_RS23820 in Burkholderia phytofirmans PsJN

Annotation: fusaric acid resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 451 to 472 (22 residues), see Phobius details amino acids 478 to 496 (19 residues), see Phobius details amino acids 502 to 521 (20 residues), see Phobius details amino acids 533 to 553 (21 residues), see Phobius details PF04632: FUSC" amino acids 39 to 719 (681 residues), 667.3 bits, see alignment E=3.1e-204 PF13515: FUSC_2" amino acids 51 to 178 (128 residues), 48 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4798)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBG0 at UniProt or InterPro

Protein Sequence (722 amino acids)

>BPHYT_RS23820 fusaric acid resistance protein (Burkholderia phytofirmans PsJN)
MKREHAIEPTADSRRRWDVVLRMLSPAVRDWTASEGLIWLHLLKTVTAGLLALGIAMLLD
LPQPRIAMTTVFVLMQPFSGMVLAKSFYRILGTAVGTLAALVLGALFVQQPELYMLGMIG
WVSACIAAAVRYRHFRWYGFVLAGYTAALIGIPNVTAPHDLFLAALTRAAEVAVGIVSSS
AVSALIVPQRSSLALRRALQIRYGNFTAFAADVLTHGIKRGQFERRFAGLVDEIVGFEAT
RTFAAFEDPAMRSRNQHLGRLNGEFMDACARLHALHQLLKRLRVNGSAPIVAAIKPYFDE
LAALMAPQLDAPVDASRTAARLQHFQASLPRRVRETRRPLEAAPVESLADFDTAAELLYR
FVDEWIRYSLTYASVTQRKRNDSQPRTKSRYVSKTNTFVVALTFIRSAVVMAIAGWFWIM
TDWPSGGLAVIGAALACALTSTAPNPSKMAVQMAVGAVLATMTGYLFTCYVYPNIDGFPL
LCTTLAPVLALGAFIATRKLAAGYGIGFSVFFCLLAGPDNVVTYAPDLLINNGMALTASM
LLAALVFAVVFPADMPWLIGKIMGDLRAQVVLACKDELPGLNQRFQSSTHDLTSQLRMLL
TRRSRRRREALRWTLATLEVGHAVIDLRNETARAGYAHALHPRWTGAVELARDDLARLFE
RPDSRALEQALVSVRAATWLAQNMLQMVHPDRDKRHDLQRILSCLHFIRTALLDKDAPFN
PH