Protein Info for BPHYT_RS23765 in Burkholderia phytofirmans PsJN

Annotation: phosphonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 25 to 53 (29 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details TIGR03255: 2-aminoethylphosphonate ABC transport system, membrane component PhnV" amino acids 33 to 283 (251 residues), 380.7 bits, see alignment E=2.4e-118 PF00528: BPD_transp_1" amino acids 100 to 285 (186 residues), 37.5 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K11082, 2-aminoethylphosphonate transport system permease protein (inferred from 100% identity to bpy:Bphyt_4792)

Predicted SEED Role

"2-aminoethylphosphonate ABC transporter permease protein II (TC 3.A.1.9.1)" in subsystem Phosphonate metabolism (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDW7 at UniProt or InterPro

Protein Sequence (287 amino acids)

>BPHYT_RS23765 phosphonate ABC transporter permease (Burkholderia phytofirmans PsJN)
MAVELDPTVLPVMHKKARPVRRSLVVRMLGGLFLGFAALLCFWLFVLPVLVVALSSVAAH
WSGTILPDGFSMRWFERLGSSDFDALTTSLEIGMGVAVLGTILGLWLALALEGRDRRGLG
AIVDTIAMMPNGVPSVVLGLAVLIAYHKRPFDLSSSAAIVVFVQLALVLPFCYRCAAAAL
RPELTILREAAASLGAPPSMVLRRVVLPQLVPAIRASLALGFALSLGELGATLTVYPPGF
ATVPIVVVGQVERGYYLPASALSLILLLVSLAALLLIAARVPRRRVD