Protein Info for BPHYT_RS23750 in Burkholderia phytofirmans PsJN

Annotation: phosphonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR03227: 2-aminoethylphosphonate ABC transporter, 2-aminoethylphosphonate binding protein" amino acids 19 to 362 (344 residues), 568.5 bits, see alignment E=2.6e-175 PF13531: SBP_bac_11" amino acids 41 to 292 (252 residues), 70.4 bits, see alignment E=4e-23 PF01547: SBP_bac_1" amino acids 50 to 292 (243 residues), 57 bits, see alignment E=6.8e-19 PF13416: SBP_bac_8" amino acids 58 to 309 (252 residues), 67.6 bits, see alignment E=3.3e-22 PF13343: SBP_bac_6" amino acids 88 to 333 (246 residues), 80.4 bits, see alignment E=3.1e-26

Best Hits

KEGG orthology group: K11081, 2-aminoethylphosphonate transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_4789)

Predicted SEED Role

"ABC transporter, periplasmic ligand binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDW4 at UniProt or InterPro

Protein Sequence (362 amino acids)

>BPHYT_RS23750 phosphonate ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MTKTNSLHATAGLARKLLPALVAAAAFGATAMQAHAADAVVLYTADGLENLYKDVLPAFE
KKEGVKVNIVTAGSGEVVNRATIEKDQPKADVLVTLPPFIQQADQSGLLQAYQSANYKNV
PAIAKAPNGAWATFVNNYFSFAINPEVTKTQPKTFADLLHPDFSGKIAYSNPATAGDGMA
VIILTSSLMGEDKAFDYLKKLENSAKFHTKGTGYLDVLLSRNEIAVANGDLQMDLDDAAN
GGLSLKPIFLAHEGGQPTTFQLPYAIGLIKNGPNQAEGKKLIDYLMSTEVQAKVPDIFGI
PGRTDVPLTGKNGEAVKKAIAGVKLIPVDWNQVMTKKADWTARWKSDVIGSSGKQIEVVK
PK