Protein Info for BPHYT_RS23565 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details transmembrane" amino acids 48 to 49 (2 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 39 to 295 (257 residues), 54.7 bits, see alignment E=1.3e-18 PF00005: ABC_tran" amino acids 367 to 515 (149 residues), 106.9 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4750)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDS5 at UniProt or InterPro

Protein Sequence (597 amino acids)

>BPHYT_RS23565 ABC transporter (Burkholderia phytofirmans PsJN)
MRRRRQSRVLSRYAGRPIRLIWRYVARRKLAHAVVLASVVAAVGCALGSQYGIRNLVDAL
PGGRAHPQHVIHAFAVLVALILADNLFWRIAGWVSARTFVAVTGDIRREMFDYLTVHAPT
FFSDKQPGVLSSRISATANAVYVIENTVAWTALPPCLTVIGAIVMVGAVSIPMSLTLVGI
SAGLAFCLFLLARKGTSRHEAFAAQAASVDGELVDVIGNMGLVRAFCALVLERRRFDTLL
AAEGDARRRSLLYLEKLRLLHAFAICILSAGVLGWTVWLWSVGRATTGDVVLIGSLGFSI
LHGSRDIAVAFVDLTQYVARLGEASETLLIPHAMPEPTRATPLEVRQASVDFENVTFAYP
GRRPVLTGLNLHIGAGERVGLIGPSGAGKSTILALLQHFYEPDSGCVRISGQDIAHVTLQ
SLQGAISIVPQDASLFHRSLLDNIRYGCPDATEADVRRACEDAYCLDFINAMPEGLNTIA
GDRGTKLSGGQRQRIAIARAILKDSPILLLDEATSALDTASETAIQAALERLMQHRTVIA
IAHRLSTLQSFDRIVVLNRGRVVQQGTPAELAAVPGIYRDTLARQIRRTPAPRPELM