Protein Info for BPHYT_RS23555 in Burkholderia phytofirmans PsJN

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 49 to 377 (329 residues), 244.1 bits, see alignment E=8.8e-77 PF13533: Biotin_lipoyl_2" amino acids 74 to 122 (49 residues), 48.3 bits, see alignment 1e-16 PF16576: HlyD_D23" amino acids 75 to 296 (222 residues), 39.3 bits, see alignment E=6.7e-14 PF13437: HlyD_3" amino acids 185 to 287 (103 residues), 38.1 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 45% identical to MDTA_CROTZ: Multidrug resistance protein MdtA (mdtA) from Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 100% identity to bpy:Bphyt_4748)

MetaCyc: 45% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDS3 at UniProt or InterPro

Protein Sequence (409 amino acids)

>BPHYT_RS23555 multidrug transporter (Burkholderia phytofirmans PsJN)
MSDAPAIQVKRPRRGRIVLAIVVLALIALVAFHVLRSKPAKPTVAPQVVTVAAATTGPMP
EILSELGTVTPVATVTVLPQLSGYLTAVGYREGQDVQKGQFLAQIDPRQYEISKRQAEAQ
LAKDKAALAQARADLARYTQLNEHKSIAEQTYADQKFLVQQDEAAIKADEANIAQFDLDL
IYCHITAPVSGRVGLRLVDPGNYVTASSQPGIAVITTMKPTTVQFTVPQTALDKVLQRVN
AGAQLPVTVFSSDNSRQIATGTLYAINNQMATATGTVTLRATVPNDDEALFPNEFVNVKL
LVDTLQNAVLVPTPAVQSGAPGDYVYLVNADNTVSVRKVTLGPGDGRHTVITAGLAAGNV
VVTDGMDRLSDGVKIKPSAARPAAGASGASGASGATPPGSAANAASAAS