Protein Info for BPHYT_RS23500 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 106 to 122 (17 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 329 to 346 (18 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details PF04632: FUSC" amino acids 32 to 180 (149 residues), 50.6 bits, see alignment E=1.9e-17 PF06081: ArAE_1" amino acids 40 to 133 (94 residues), 26.3 bits, see alignment E=1e-09 PF13515: FUSC_2" amino acids 45 to 175 (131 residues), 52.9 bits, see alignment E=6.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4736)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDR2 at UniProt or InterPro

Protein Sequence (392 amino acids)

>BPHYT_RS23500 hypothetical protein (Burkholderia phytofirmans PsJN)
MTLAGTLAQLCRTAVFGLGRELAAWKASRARATFAAQAMLSVALSVALANSLGLSDTWWA
AISGFAVMQTSFAGSVQRAAHRIIGTVTGAALGAIAGPWIGDRPWVFVPALGAIGAVAVY
RANGSKATYAWVLGGVTALMVTYEAHKFASFRATALFATLRVAEVAVGTFACLLVASVFH
FGPKWYRRNRTPTDATAARVAGESAGLPGAAESTPPLESARSTRMLLCLQAALSITTLAS
LTYVLHLPGFAQAMVTAIAVLVVPPGLTADRTRQPVMEKMVQRVAGCLLAGTIGVALLPL
MQGQAILCMLALSIGVWAGCHVQTGRQGASYVGRQFTIAFIMVFVQDHHWSSDPMPALMR
LSGILTGIVVLAAVMFVTSRLYMPPMPQDASR