Protein Info for BPHYT_RS23435 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 282 to 305 (24 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 239 (215 residues), 97 bits, see alignment E=1.2e-31 amino acids 284 to 434 (151 residues), 32 bits, see alignment E=6.6e-12 PF07690: MFS_1" amino acids 30 to 389 (360 residues), 93.9 bits, see alignment E=9.8e-31 amino acids 262 to 437 (176 residues), 36.9 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4723)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDP9 at UniProt or InterPro

Protein Sequence (469 amino acids)

>BPHYT_RS23435 MFS transporter (Burkholderia phytofirmans PsJN)
METRVNPARPQATAPASTAMLRRVAFASTIGTAAEYYDFFVYGTAAVLVFGQKFFPSADP
LIGTLAAFATYAVGFLARPLGGIVFGHFGDRVGRKKALIVTILIVGLGTFAIGLLPDYQS
IGIWAPIALIVIRVLQGFGVGGEQAGAVLLTAEYAPPARRGFFASLVQLGAPAGFLIPSG
LFALLGATLTQAQLLDWGWRIPFLASALLVAVGLYIRLRTEESPIFATIQRTKAVASRPV
VEVVRQFGPTIVKGVGAKLIEACAFAMYTMIVLAYGKAHGIAQGMLLETVIVAVALELVT
IPLAGALSDRIGRRTTFIAGALLHVALVVPFFMAIDSGNRAAIQLVMILAISVGHSLCYA
PQAALFPELFPARVRCSGIALIWQIGSLLGSGVLGLLAVKLIQLTHGNSLALIVYVAVLG
IVSAVSLFALPETAPLRRGGDLHDWGGGEPVEARTAARASSSSSSLAQP