Protein Info for BPHYT_RS23370 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF13477: Glyco_trans_4_2" amino acids 5 to 143 (139 residues), 63.4 bits, see alignment E=9.7e-21 PF13439: Glyco_transf_4" amino acids 22 to 110 (89 residues), 35.5 bits, see alignment E=3.6e-12 PF13579: Glyco_trans_4_4" amino acids 22 to 143 (122 residues), 57.1 bits, see alignment E=1e-18 PF20706: GT4-conflict" amino acids 190 to 315 (126 residues), 27.8 bits, see alignment E=4.5e-10 PF13692: Glyco_trans_1_4" amino acids 201 to 340 (140 residues), 98.9 bits, see alignment E=1.1e-31 PF00534: Glycos_transf_1" amino acids 201 to 355 (155 residues), 94.2 bits, see alignment E=2.4e-30 PF13524: Glyco_trans_1_2" amino acids 281 to 363 (83 residues), 30.8 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4709)

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDN5 at UniProt or InterPro

Protein Sequence (396 amino acids)

>BPHYT_RS23370 glycosyl transferase family 1 (Burkholderia phytofirmans PsJN)
MNGRKVVLFANTDWYLYNFRLSLAQRLRQDGYDVVLLSPPGEFGPKLQALGFSWHAVPMN
RRSLNPLREVGVLAWLVRFLRREKPDLVHGFTIKSAVYGSLASKLAGVPARINAVAGMGY
VFTSRDLKARVLRPIVRQLMRSALNGRRNALILQNPDDVAIFKRAKIVDDQSIQLIKGSG
VNCSRFSARPQTDEDAQAPLRVVLAARLLWDKGIAEYVEAARALRDENRTVRFLLAGSPD
DGNPASVPRELVEGWANDGLLTWLGHVSDMPKLLSEVDVVVLPSYREGLPKTLIEAAACA
LPLITTDVPGCREVVSGTGDDGLLIPVRDAAALANAIRLLDDDRELCRKLGLAAQAKALS
EFDESIVISKTLRVYSELLDPAPREVVVASQRERQI