Protein Info for BPHYT_RS23255 in Burkholderia phytofirmans PsJN

Annotation: TetR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00440: TetR_N" amino acids 28 to 73 (46 residues), 55.1 bits, see alignment 1.1e-18 PF08359: TetR_C_4" amino acids 81 to 205 (125 residues), 44.5 bits, see alignment E=3.4e-15 PF16295: TetR_C_10" amino acids 82 to 182 (101 residues), 29.6 bits, see alignment E=1.6e-10 PF17932: TetR_C_24" amino acids 94 to 179 (86 residues), 28.3 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4685)

Predicted SEED Role

"Predicted transcriptional regulator LiuQ of leucine degradation pathway, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDL3 at UniProt or InterPro

Protein Sequence (249 amino acids)

>BPHYT_RS23255 TetR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MTVATKAELPASRRQPAGRKSQQRVKEILQAGRDVFSEKGYERATTAEIAQRLGISEATV
FSYFRGKRELCARVIGDWYDEIIDAIESGLPRDGNVRQQFAFIVRTHLRLMLVNGTDLCA
LVLSEGRARHHELSEALTELQRRYTAPLMRVLAQGQESGQIRADMPLRLLRSMVFGPMEH
VLWDATLANRHIDIDATADQLIDVLWAALTPPDLAVSALQQFRVEVAEANRRFEEATRGA
MDTPAEGNE