Protein Info for BPHYT_RS23200 in Burkholderia phytofirmans PsJN

Annotation: cupin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details PF00190: Cupin_1" amino acids 41 to 127 (87 residues), 30.3 bits, see alignment E=2.9e-11 PF07883: Cupin_2" amino acids 47 to 117 (71 residues), 43 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4674)

Predicted SEED Role

"Cupin 2, conserved barrel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDK4 at UniProt or InterPro

Protein Sequence (138 amino acids)

>BPHYT_RS23200 cupin (Burkholderia phytofirmans PsJN)
MSDVLHDARARVVKVRPDRAMATTQRLPYFVGISAGTAGSTGLSMYMVVVPPGGHAEPHF
HADYETAIYQLEGKIETRYGPGLRESVITEPGDFLFIAPGVPHQPFNLDATTAARAIVAR
NHADEHERVVPYDPASDA