Protein Info for BPHYT_RS23195 in Burkholderia phytofirmans PsJN

Annotation: cytochrome P460

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details PF09335: SNARE_assoc" amino acids 30 to 156 (127 residues), 40.6 bits, see alignment E=3.5e-14 PF00581: Rhodanese" amino acids 208 to 302 (95 residues), 36.7 bits, see alignment E=4.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4673)

Predicted SEED Role

"Rhodanese-related sulfurtransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDK3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>BPHYT_RS23195 cytochrome P460 (Burkholderia phytofirmans PsJN)
MWHFPVAIPPSLGVWAVFMSVLITQLGVPIPAAPMLILGGTMAAMGQTSYASVVCAAVAA
TLIADSLWFFTGRAYGRRMLNYLVRFSLSLDTTVRLARNTYERYGAPILTVAKFLPGLGL
VSAPLLGTTAINVGVFLLWDFVGATLWASVWVIGGAALHDEIVQLMLLVRHNGGTIFDAF
AAIFVAVLLYRWVRRWQFRRWLAHTRISPDQLDEMMKSNEPPLIFDARPRSVRAKESHRI
AGARPLDLDSPEPIDPELLKRPIVVYCVCPNEATAKRIVEQLHRKNIHHIRALKGGLDAW
QKRGYPVEPLPADFHTAKAHMIEDEGEEGEYTVRARLAK