Protein Info for BPHYT_RS23145 in Burkholderia phytofirmans PsJN

Annotation: putrescine/spermidine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00005: ABC_tran" amino acids 45 to 187 (143 residues), 132.1 bits, see alignment E=2.2e-42 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 60 to 385 (326 residues), 412.8 bits, see alignment E=4.5e-128 PF08402: TOBE_2" amino acids 305 to 385 (81 residues), 63.9 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K11076, putrescine transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_4663)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDJ3 at UniProt or InterPro

Protein Sequence (387 amino acids)

>BPHYT_RS23145 putrescine/spermidine ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MNSTTSKSAAGATQMARPAVTTKSKSDEFVRIENVVKKFGDSTAVDNVNLSIAKNELFAL
LGSSGCGKSTLLRMLAGLETVTSGRIFVDGEDLAAMPPYKRPVNMMFQSYALFPHMSVEA
NIAFGLKQEGTPKNEIKERVADALNLVQMSKYAQRKPHQLSGGQQQRVALARSLVKRPKL
LLLDEPMSALDKKIRQKTQLELVNIIEKVDVTCVMVTHDQEEAMTMAGRLAVMSEGRIVQ
IGSPSQVYEFPNSRFSAEFIGSTNLFEGTVVADEPDHIFVESEELESRIYVSHGITGPLG
MPVGISVRPERIKVSLDKPTTPHNWARGVVADVAYMGSYSLYHVRLPSGKTVVSNLSSSH
LMAEGAPSYNDDVFVYWSPASGVVLTQ