Protein Info for BPHYT_RS23095 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 350 (331 residues), 165.3 bits, see alignment E=1.9e-52 amino acids 262 to 400 (139 residues), 45.7 bits, see alignment E=4.3e-16 PF00083: Sugar_tr" amino acids 44 to 398 (355 residues), 74.4 bits, see alignment E=8.8e-25

Best Hits

KEGG orthology group: K08196, MFS transporter, AAHS family, cis,cis-muconate transporter (inferred from 100% identity to bpy:Bphyt_4653)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDI3 at UniProt or InterPro

Protein Sequence (410 amino acids)

>BPHYT_RS23095 MFS transporter (Burkholderia phytofirmans PsJN)
MSQTSVSQGRWLLVFILGYLALMADGADVMMYGLTLTRIKDDFGLSNVQAGALGSLTLLG
MAVGGILGGWASDRIGRVRVVVWALALFSLGAGLLGLTHSFVEFAIVRFIGSLGIGSMVL
VTTLVAEYVPTERRSLILGALQTGISAGYIVVIALSSWILPHYGWRTLYYVSAIPVVFAL
AIKFAVPEPASWRASQAIERTSQRRWRDSRYHVIFSNRQTRTLFILWTLASVFILSGFYG
LNNWLPTYLEKELHIKFSSLTGYMIGTYVVAFIGKIFAGWLGDRWSRRGVYVLGCVGAAL
FLPVIIFWHTRENIAVLMLFFGFLYGVPLGTIGTFMSESFATSIRGTAVGGSYNLGRFCS
GAAPIVIGFLATQFSIGLGFLVVGAVFFLSGVTALFIPDRLYDTDRPSTP