Protein Info for BPHYT_RS23065 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 366 to 382 (17 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 428 to 448 (21 residues), see Phobius details amino acids 454 to 475 (22 residues), see Phobius details PF07690: MFS_1" amino acids 93 to 402 (310 residues), 91.3 bits, see alignment E=5.9e-30 amino acids 358 to 474 (117 residues), 36.4 bits, see alignment E=2.9e-13 PF00083: Sugar_tr" amino acids 96 to 487 (392 residues), 124.2 bits, see alignment E=6.8e-40

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to bpy:Bphyt_4647)

Predicted SEED Role

"benzoate MFS transporter BenK" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDH7 at UniProt or InterPro

Protein Sequence (488 amino acids)

>BPHYT_RS23065 MFS transporter (Burkholderia phytofirmans PsJN)
MASPDHAGSVAKQSGGAAHSDSTVNRTVAAAPLDAGSISARLDRLPATRSVWKLVVLLSL
GFFFELYDLLYSGYVAPGLVKSGLLSATTHGLFGSTGVASFIAALFSGLFIGTIACGFLA
DRFGRRAVFTYSLLWYTAANVVMAFQETATGLNFWRFVAGIGIGVELVTIGTYISELVPK
QIRGRAFACEQAVGFTAVPVVAFLSYLLVPRTLLGLDGWRWVVLIGAHGALFVWWIRRAL
PESPRWLAQQGRLAEADRVMTALEAKVRREYGRELPPPAPPVAVAPRGSFRDMWVPPYRS
RTLMMTIFNIFQTVGFYGFANWVPTLLIKQGITITTSLMYSSVIALAAPVGPLIGLFIGD
RFERKTVIVVMAGVNIVCGLWFSQASGAVLLVSLGVCLTLAGNIISYSYHAYQTELFPTS
IRARAVGFVYSWSRFSAIFTAFLIAAVLKQFGTTGVFVFIAGAMLIVMLAIGLMGPRTKG
IELEKISR