Protein Info for BPHYT_RS23020 in Burkholderia phytofirmans PsJN

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00034: Cytochrom_C" amino acids 192 to 303 (112 residues), 23.5 bits, see alignment E=1.8e-08 amino acids 330 to 417 (88 residues), 50.2 bits, see alignment E=8.2e-17 PF13442: Cytochrome_CBB3" amino acids 329 to 413 (85 residues), 34.8 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 60% identical to GADH2_PANCY: Gluconate 2-dehydrogenase cytochrome c subunit from Pantoea cypripedii

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4638)

MetaCyc: 65% identical to D-gluconate dehydrogenase cytochrome c subunit (Pseudomonas fluorescens)
Gluconate 2-dehydrogenase (acceptor). [EC: 1.1.99.3]

Predicted SEED Role

"Gluconate 2-dehydrogenase (EC 1.1.99.3), membrane-bound, cytochrome c" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.3

Use Curated BLAST to search for 1.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDG8 at UniProt or InterPro

Protein Sequence (451 amino acids)

>BPHYT_RS23020 alcohol dehydrogenase (Burkholderia phytofirmans PsJN)
MTKKIDIQRLTQAMKRVGAAAVLGMTTLAAHAAAPQSRNDTTLIAHGEYLARAGDCIACH
SAPSGKPFAGGLKFDTPIGAIYSTNITPDRSTGIGSWTFAQFDRAVRAGVKPNGDTLYPA
MPFPSYARLSQDDMHALYAYFTHGVAPVNQKNKPVDIVWPLSMRWPLGIWRHLFAPEPVS
FDAKRYADPVIARGAYLVQGLGHCGACHTPRAATMQERALSEFDGPAFLAGGAAIDGWIP
SSLRGNPRTGIGAWSEADLVQFLKTGRTQHSAAFGGMTDVVQHSMQHMNDADLTAIARYL
KTLPSTDPQETPYAYDDTAARALRMGDASAPGAAVYRDNCTACHRSDGRGYNRVFPALGG
NPVVQGKDATSLIHVLLTGSTLEGTKTAPSSFTMPAFGWRLNDQEVADVTNFVRTSWGNS
GSTVSATDVAKVRKTVTVHAPDMPPGAALSH