Protein Info for BPHYT_RS22975 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14559: TPR_19
  • amino acids 60 to 119 (60 residues), 26.9 bits, 4.3e-09
• PF13181: TPR_8
  • amino acids 82 to 114 (33 residues), 21.6 bits, see alignment (E = 1.5e-07)
  • amino acids 117 to 149 (33 residues), 20.3 bits, see alignment (E = 4e-07)
  • amino acids 150 to 177 (28 residues), 11.9 bits, see alignment (E = 0.00019)
  • amino acids 184 to 216 (33 residues), 27.7 bits, see alignment (E = 1.7e-09)
  • amino acids 219 to 251 (33 residues), 12.6 bits, see alignment (E = 0.00011)
  • amino acids 286 to 318 (33 residues), 15.8 bits, see alignment (E = 1.1e-05)
  • amino acids 321 to 352 (32 residues), 13.9 bits, see alignment (E = 4.5e-05)
• PF13432: TPR_16
  • amino acids 88 to 149 (62 residues), 28.7 bits, 1.2e-09
  • amino acids 130 to 181 (52 residues), 28.9 bits, 1.1e-09
  • amino acids 189 to 251 (63 residues), 27.7 bits, E=2.6e-09
  • amino acids 256 to 318 (63 residues), 27.7 bits, E=2.5e-09
  • amino acids 304 to 351 (48 residues), 23.4 bits, 5.7e-08
  • amino acids 326 to 385 (60 residues), 27.3 bits, 3.4e-09
• PF13374: TPR_10
  • amino acids 118 to 146 (29 residues), 20.3 bits, see alignment (E = 3.7e-07)
  • amino acids 188 to 214 (27 residues), 22.1 bits, see alignment (E = 1e-07)
  • amino acids 220 to 248 (29 residues), 16.3 bits, see alignment (E = 7e-06)
  • amino acids 252 to 280 (29 residues), 14.9 bits, see alignment (E = 2e-05)
  • amino acids 324 to 348 (25 residues), 15.3 bits, see alignment (E = 1.5e-05)
• PF13414: TPR_11
  • amino acids 133 to 163 (31 residues), 34.3 bits, see alignment (E = 1.3e-11)
  • amino acids 191 to 228 (38 residues), 35.7 bits, 4.6e-12
  • amino acids 267 to 298 (32 residues), 28.9 bits, see alignment (E = 6.2e-10)
• PF13431: TPR_17
  • amino acids 139 to 171 (33 residues), 23.8 bits, see alignment (E = 3.1e-08)
  • amino acids 274 to 306 (33 residues), 22.8 bits, see alignment (E = 6.8e-08)
• PF07719: TPR_2
  • amino acids 184 to 216 (33 residues), 30.2 bits, see alignment (E = 2.5e-10)
  • amino acids 286 to 318 (33 residues), 26.5 bits, see alignment (E = 4e-09)
• PF13424: TPR_12
  • amino acids 184 to 249 (66 residues), 35.7 bits, E=7.1e-12
  • amino acids 285 to 348 (64 residues), 31.7 bits, E=1.2e-10
• PF00515: TPR_1
  • amino acids 184 to 217 (34 residues), 30.7 bits, see alignment (E = 1.7e-10)
• PF01075: Glyco_transf_9
  • amino acids 620 to 652 (33 residues), 23.6 bits, see alignment (E = 2.5e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4628)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

See B2TDF9 at UniProt or InterPro

Protein Sequence (714 amino acids)

>BPHYT_RS22975 hypothetical protein (Burkholderia phytofirmans PsJN)
MNHTQLASPIDDINQRAVSSFSAGQFAEALSMVTPLVDGDAMPDGALADALNIAGACSFA
LQRPAEAERYWRRCLQLRPDYADVYGSLGMLLKSLGRLSAAKAMYRQLVALRPGDPDARN
HLGAVLYGLGYKEEAEASYRQALAIRPDYAEAHYNRGIVLHELRRPQEAEAAFRDALPGL
PAHAEVHNNLGNVLMELGRLAEADAAYREALTIRPQYPEALNNLGGVLKATFRHTEAELA
FRLALAIRPDYAEALLNLGTVLADFERLPEAEAAYRDAIAQRPDYAEAHYNLGVTLCKME
HLFEAEAAYREAIRLRPDLVHAHNNLGCVLRRLDRLPAAVDAFEQALGVCPDMAEAHYNL
GAARAQLMQFPEAESAYRRALALRADYGDAKFGLSVLLLGMGRFEEGWRLYECRYQQPGF
VHHKTVAMLGCPQWQGDTLADKSLLVWQEDGLGDMIQFSRYFALLKAQGASHIAFACAPS
LHRLMACVDGVDAVLDHDTARAQTSAYDCWTSLLSAPLHLRTSVDTIPRAVRLAAEPALV
ERWRPVLDALPSGRRIGLVWKGNANHHNDVNRSIPSLAILAPLWSVPGVSFVSLQKGRGE
DEARQPAADQPLLDLGSRVTDFADSAAIIAQLDLVICVDTSTAHLAASLGKPCWVMLPEK
DIDWRWLHDRNDSPWYPHTLRLFRRAPGEDWSMPVERVREACVERFGAADHTPN