Protein Info for BPHYT_RS22960 in Burkholderia phytofirmans PsJN

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 428 to 450 (23 residues), see Phobius details amino acids 475 to 497 (23 residues), see Phobius details PF03929: PepSY_TM" amino acids 27 to 452 (426 residues), 263.7 bits, see alignment E=3e-82 PF03413: PepSY" amino acids 357 to 398 (42 residues), 20.5 bits, see alignment 4.8e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4625)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDF6 at UniProt or InterPro

Protein Sequence (512 amino acids)

>BPHYT_RS22960 peptidase (Burkholderia phytofirmans PsJN)
MSTTTGADVRRVTPATTAVHPGYRTLWRWHFYAGLFVMPFLVVLAITGTLYCFQPQIEPL
LYPGRLIVAPQAAPKLPEEALLARARAAMPPTALALTAVVANAPEHSAEFVFRLADGDKQ
SVYVNPYTGAVLGTLSVERRFMQVDRMLHRKLLLGKPGELLMELAACWTLVMIGTGVALW
WPREKTTARAALLPRFALKGRALWKNLHAVMGVWLALGALAFVLTGLPWTGSWGKQFKAL
ATAANLGAPPGSRGALPMRSVMPAKNGAQHSAPDTHADNTAHNEHAEHNGHGVHDASMNS
MPGMVMDDLPLPLTPWAVGNTRVPDSRPPTAADEAGAAHPLPLGRVVALVASLGVTEGYN
IVLPASATGVYTVSYFPDDPKDQRTLYIDQYSGAVLKDIRYADYGAVSKAVSYGTSLHMG
RYFGVANQILCAVISMGLAAMAITGCVMWWKRRPQRSLGAPSRERAAPPMRGWKIGLVLL
GIVFPLMGATLLAVWLVDRAIFGRAARRAATP