Protein Info for BPHYT_RS22950 in Burkholderia phytofirmans PsJN

Annotation: von Willebrand factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details transmembrane" amino acids 21 to 38 (18 residues), see Phobius details PF13400: Tad" amino acids 17 to 62 (46 residues), 24.8 bits, see alignment 3.2e-09 PF00092: VWA" amino acids 150 to 264 (115 residues), 36.6 bits, see alignment E=8.4e-13 PF13519: VWA_2" amino acids 151 to 260 (110 residues), 33.3 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4623)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDF4 at UniProt or InterPro

Protein Sequence (451 amino acids)

>BPHYT_RS22950 von Willebrand factor A (Burkholderia phytofirmans PsJN)
MKTKAKTKAAFRRRQRGSVSIFVAVSLIALLGILGLAVDSGFGYMIKARLDAATDGAVIA
AGEAVTRGNNQTEQTNNAQQAATAFFAANYPAGFLGSSVSAGTPSIVFNAGTVTIGMTAQ
ASVPVTFSKVLGFNVLNVSSSSQAIRKTLDMVFVIDNTKSLNTSGVPAAVRSNAVAFLNN
FDVTNDRVALMHFAYGTVVDVPFKGNTRGFDRATMTTDINKYTFDGSTNSPEALWNARNQ
LNTVITQPSSLRVIVFFSDGAPNSFSSFFTTNQSKCNNISTTLASGDGPSGSASGLFSIN
ALSQKLASPCYQNDTSGFVTAMPKWYNAHNVNEQTFPIWPVTSPRVVSNGNATYVNVNRV
SRNLLEAMAAAARAEGTYVFTLGYGNELTKPAGPDNELGQDVLKCMANTADSLSRCYNPK
QPVGVYCYAATPADLKPCFSQLASQILRISK