Protein Info for BPHYT_RS22925 in Burkholderia phytofirmans PsJN

Annotation: pilus assembly protein TadB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details PF00482: T2SSF" amino acids 158 to 282 (125 residues), 74 bits, see alignment E=5.6e-25

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 100% identity to bpy:Bphyt_4618)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD71 at UniProt or InterPro

Protein Sequence (325 amino acids)

>BPHYT_RS22925 pilus assembly protein TadB (Burkholderia phytofirmans PsJN)
MNTSFIGFAVLAFLAVVLAIEAVYLFWSSHHGKDVKRMDERIRALSAGGNVSSQQLSILK
QRMLSESPFVTQLLLRIPRVHALDRQLQQSGLKWSVARFVTYTLLCAVLGALGGFVLLLP
APVMGVFAVVASLLPTLILCRKRTKRVLQLERQLPDAADLIARALRAGHSFPAALGMVGE
ELPNPLGGEFALVFDEINYGVSMSDALLNMVNRVPVEDLRYFVIAVLIQREAGGNLAEIL
GSIAGIIRERLKLLGKVRVLSAEGRLSAWVLGVLPFAILGLLSVLNPGYISVFWKDPAGP
QIAGVAIAMMLFGILWMRKVVRIRV