Protein Info for BPHYT_RS22905 in Burkholderia phytofirmans PsJN

Annotation: secretin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details PF13629: T2SS-T3SS_pil_N" amino acids 112 to 180 (69 residues), 67.5 bits, see alignment E=6.6e-23 PF00263: Secretin" amino acids 350 to 517 (168 residues), 143.4 bits, see alignment E=5.3e-46

Best Hits

KEGG orthology group: K02280, pilus assembly protein CpaC (inferred from 100% identity to bpy:Bphyt_4614)

Predicted SEED Role

"Type II/IV secretion system secretin RcpA/CpaC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD73 at UniProt or InterPro

Protein Sequence (595 amino acids)

>BPHYT_RS22905 secretin (Burkholderia phytofirmans PsJN)
MNTRTTQRASAPRHPLGPREANSRLPRGRTRIAEACTCVLLGMYLTMLPVAQAAGQNAAA
GVPGLPDVPLTVASNGSVHLTIAASGMGPGAASGGAQQGARGPNCSGPVAEHSSVTIPVG
KSTMVDVREPVKSRSVGNPAIVQAMLVSPQTLYLLGSDVGTTNMIVQGRSGSCTIIDVSV
GADPGGLQQTLAALMPEETGIQVKAAADTLVLTGTVSDAVKAERVLELARAFVARPTAAL
QGGAPMGSGPLPVGAAPRAMGMPAPTLGGASGERIINMMHVAAPQQVMLEVKVAEVSKTL
IDQLGVAANINGGIGSWSFGLLADYLSGGLSALTASKANNSPLRAAIDAQKTDQLVKILA
EPNLMAISGQEASFLAGGKVYIPVPQSNGANGTTIVLQEEQYGVGLTFTPTVLEGGRINL
KVSPEVSELSSTGVVVSAGNSNNQTILPLITTRRASTTLQVFDGQSFAIGGLLKSNITGS
IKGLPGAAELPVLGALFRSTSYEQDKTELVFVVTPRLAKPLPQHYPLPTDHFGDASEANV
YLTGHMEGEKRAAPAAGASAPAPAPVPVPAPAPSAAASVAVIPATPETSASNAAQ