Protein Info for BPHYT_RS22860 in Burkholderia phytofirmans PsJN

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 109.7 bits, see alignment E=8.7e-36 PF00486: Trans_reg_C" amino acids 160 to 235 (76 residues), 74.5 bits, see alignment E=5.7e-25

Best Hits

Swiss-Prot: 48% identical to OMPR_ECOLI: Transcriptional regulatory protein OmpR (ompR) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 100% identity to bpy:Bphyt_4604)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD62 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BPHYT_RS22860 chemotaxis protein CheY (Burkholderia phytofirmans PsJN)
METIDHVLIVDDDRGIRELLAGYLEKNGMRVSLAANGRQMRAALEQGAPDLIVLDLMMPG
EDGLVLCRELRAGKFRAVPVLMLTARNEEADRIVGLEMGADDYLPKPFAVRELLARIRAV
LRRARMLPPGMQVTESAPMLAFGDWRLDTTARHLLDAEGTMVALSGAEYRLLRVFLDHPQ
RVLTRDQLLNLTQGRQADQFDRSIDLMVSRLRQRLRDVAREPRYIKTLRSEGYVFSAAVT
AIGDPQ