Protein Info for BPHYT_RS22815 in Burkholderia phytofirmans PsJN

Annotation: TonB-denpendent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 781 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 29 to 108 (80 residues), 62.7 bits, see alignment E=7.3e-21 PF13715: CarbopepD_reg_2" amino acids 30 to 111 (82 residues), 34.5 bits, see alignment E=3.4e-12 PF07715: Plug" amino acids 133 to 230 (98 residues), 29 bits, see alignment E=2.6e-10 PF00593: TonB_dep_Rec" amino acids 297 to 726 (430 residues), 108.4 bits, see alignment E=1.6e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4595)

Predicted SEED Role

"Zinc-regulated outer membrane receptor" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD53 at UniProt or InterPro

Protein Sequence (781 amino acids)

>BPHYT_RS22815 TonB-denpendent receptor (Burkholderia phytofirmans PsJN)
MTIRTRVSSAALLLFAMAAHAHAATDESSVTGAVTDAAGQPVNNATVIVQNASGAAVTEA
KTNAEGRFAIAHVTPGTYAIVVTAPGFASGNSITTTSAGAESTVSVSLAKSGTLDVQVNA
KRLDRARNGLLPETGSSVYRFSQADIEALPAGQDTPLNQVLLQAPGVASDSYGQLHVRGD
HANLQYRINGIIIPEPISGFGQALDTRIIDQVNLLTGALPAQYGYRTAGVVDIRTKTGDA
GNGGTIDVFGGSHQTLKTSADVFGTQGPFSYYFSGSLGVNNLGIENPTASASALHDHTRQ
GDAFGYMSYIINPLTRVSLMFGTTSNQFEIPNTPGLPTNFTLNGNNAFDSSQLDETQSEL
NNFAVLALQGTNGGALDYQVALFTRYTRTQFNPDPVGDLLFNGVASQDFHSNSANGAQVD
TTWRLNEKHTIRAGLFFQQEHAVFDDSVDVFAADSEGNQLSDQPFNIHDSSSRTGYLYSA
YVQDEWKITDKLTLNYGLRYDKMDEYVSASQLSPRIGLVYALTPTTTFHAGYARYFTPPA
FELVSGSTISRFNGTTNQSPSSQNDQVQPERSHYFDLGVTQRLGSNVTVGIDAYYKKSTN
LLDEGQFGSALIFTPFNYQYGRVYGLEFTANYKQDNASAYLNFAYSRAQGKQIDSAQFNF
EADELAYINDHWVYLDHDQRITASFGGTYDLGRTTFTFDGLVGSGLRSGFANTDRLPVYA
QINLGVIQHFNQPLVGKFDARLLVVNAFNRVYELRDGSGIGVGAPQYGPHFAVYAGITKH
F