Protein Info for BPHYT_RS22810 in Burkholderia phytofirmans PsJN

Annotation: biopolymer transporter ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details PF01618: MotA_ExbB" amino acids 94 to 194 (101 residues), 94.8 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to bpy:Bphyt_4594)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD52 at UniProt or InterPro

Protein Sequence (215 amino acids)

>BPHYT_RS22810 biopolymer transporter ExbB (Burkholderia phytofirmans PsJN)
MQDWTNILAAVRVGGWVIYPLTVLAVVAVAIVLDRAYVFLRFGRLPPGADDAHGIHMPAS
STGMDNGLNHAPRQNVFKRMSTSWRPDASVPLWLREANAQSVASQIERDMSKGFWVLETI
VTAAPLLGLLGTIVGMMHSFQLFGGTGLVDPAGVTGGVAQSLVATAIGLVVALFALFAFN
YFSRRLERLMDELESFATARLGEIRLATSVAGAQS