Protein Info for BPHYT_RS22775 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 266 to 268 (3 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 125 to 315 (191 residues), 52.8 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_4587)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD46 at UniProt or InterPro

Protein Sequence (325 amino acids)

>BPHYT_RS22775 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MSHSVTRHTVSGPAEPGGPGLPTPGGAVRGGKPASSRRRGPSPTARRQRRAAFLFLAPAC
VMVAIYVVWPILSTIRLSFFNWDGMSEPSFVGLANYVELFHAQTFYTALKNNLIWLLLFL
LAPPMGLAVALYLNQAVAGIRIVKSLFFAPFVLSGVVVGLIFSWFYDPTFGLLAVILGHG
VPVLGDPRYATFGIVFAALWPQTAYCMILYLTGLTSLNAEQIEAARMEGARGWSMLWHVI
LPQLRPTTFMAIVVTIIGALRSFDLISVMTGGGPFESSTVLAYYMYDQAIKYYRIGYSAA
VAVVLFAIMLVYIVYHLRRMLRAEQ