Protein Info for BPHYT_RS22600 in Burkholderia phytofirmans PsJN

Annotation: transport protein RbsD/FucU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF05025: RbsD_FucU" amino acids 4 to 145 (142 residues), 125.9 bits, see alignment E=8e-41

Best Hits

Swiss-Prot: 36% identical to FUCM_ACTP7: L-fucose mutarotase (fucU) from Actinobacillus pleuropneumoniae serotype 7 (strain AP76)

KEGG orthology group: K02431, L-fucose mutarotase [EC: 5.1.3.-] (inferred from 100% identity to bpy:Bphyt_4552)

Predicted SEED Role

"L-fucose mutarotase" in subsystem L-fucose utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-

Use Curated BLAST to search for 5.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE00 at UniProt or InterPro

Protein Sequence (154 amino acids)

>BPHYT_RS22600 transport protein RbsD/FucU (Burkholderia phytofirmans PsJN)
MLKNLDPLLNADILHALRAMGHGDELVICDANFPGDSVARESVLGKVLRLDGVSAPRAIR
AVLSVMPLDTFIEHPASRMEVVGEPHTMPAVQREAQVEINAAEGRDVPFASIERFAFYER
ARKAYCVIATGEERGYGCFVFTKGVLLAPDAPQS