Protein Info for BPHYT_RS22565 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 72 (27 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 113 to 114 (2 residues), see Phobius details amino acids 116 to 142 (27 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details PF04143: Sulf_transp" amino acids 60 to 387 (328 residues), 229 bits, see alignment E=5.1e-72

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to bpy:Bphyt_4545)

Predicted SEED Role

"COG2391: Predicted transporter component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE03 at UniProt or InterPro

Protein Sequence (407 amino acids)

>BPHYT_RS22565 membrane protein (Burkholderia phytofirmans PsJN)
MSDLSTSLPRVPRRFDINPKPLGAALVLIALGAVYLAQTVSGRQAALYLVGALLGMSLYH
AAFGFTSAWRVFIADGRGAGLRAQMLMLALGVLLFFPALQAGTLFGHPVVGLVAPAGTSV
LVGAFMFGIGMQLGGGCASGTLYTVGGGSTRMIVTLAAFVIGSVVATAHMPFWTALPSLK
PLSLVTVFGAGWAIALNLAVFAAIAALTVLIERRRHGQLVNEPPRQPHTSPWLHGPWPLF
VGAIALTLLNFATLALSGRPWGVTSAFALWGAKLFATLGIDVADWPYWAAHANANSLAAP
VTHDVTSVMDIGIILGAMSAAALAGRYAPVWKVPARSLIAAVVGGLMLGYGARLAYGCNI
GAYFSGIVSGSLHGWLWLAAAFAGNVLGTRLRPAFGLEVERVRSTGC