Protein Info for BPHYT_RS22555 in Burkholderia phytofirmans PsJN
Annotation: transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 89% identical to FLHC_PARP8: Flagellar transcriptional regulator FlhC (flhC) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
KEGG orthology group: K02402, flagellar transcriptional activator FlhC (inferred from 98% identity to bge:BC1002_4404)Predicted SEED Role
"Flagellar transcriptional activator FlhC" in subsystem Flagellum
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2TE01 at UniProt or InterPro
Protein Sequence (189 amino acids)
>BPHYT_RS22555 transcriptional regulator (Burkholderia phytofirmans PsJN) MLKRSLTEDAQEVFRAIALIELGARMQVLESELTLSRDRMIRLYREVKGVSPPKGMLPFS ADWYMTWLANIHASLFYNTYLFLKNEARCSHLDALTKGYRLYLEHCQHSETEPVLDLTRA WTLVRFFDADILQLTKCCRCTGKFVAHKHDLQHNVVCGACQPPSRAGKTKKAAAARQEAL EAAQIAQAA