Protein Info for BPHYT_RS22320 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 120 to 147 (28 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details

Best Hits

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 100% identity to bpy:Bphyt_4494)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDX8 at UniProt or InterPro

Protein Sequence (245 amino acids)

>BPHYT_RS22320 hypothetical protein (Burkholderia phytofirmans PsJN)
MRRCQLVSGVVLLVYLFLHLVNHALGIWSLDLAGRGLTLALRVWRSAPGTVLLYGASLLH
FSLALRTIYGRRHWKMPLTEWVRLWAGLSLPLLLIRHVVSTRLASSLYGFEPNYERIVIA
LITSGTQGLQLALLAPGWVHGCLGLWLRMRHRAGARRAKPFLLGLLVGLPLLSAAGFVRM
KQAVLALCIGPLQTDPKLVAHQLSLDTWRHNILMLYLALLIGAFVAGQLRNWRERRRLRK
ATMTI