Protein Info for BPHYT_RS22290 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details PF03741: TerC" amino acids 18 to 209 (192 residues), 165 bits, see alignment E=8e-53

Best Hits

Swiss-Prot: 50% identical to Y056_HAEIN: UPF0053 protein HI_0056 (HI_0056) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4488)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7W0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BPHYT_RS22290 membrane protein (Burkholderia phytofirmans PsJN)
MDTLLTLVADPAAWAALLTLVVMEIVLGIDNLIFISILSNKLPEAQRARTQRIGIMLALV
MRLGLLGTVAWIAQLTAPAITLFAHAFSWRDLILLGGGLFLVWKATREIHHHVTHAEEER
SKAGSTVQLTVAAAIGQILVLDMVFSVDSIITAVGMTEHMPIMFVAVISAVLAMLFAARP
LSRFIDRNPTIVTLALSFLLVIGMTLIAEGFGSHVPKAYIYVAMAFSAFVEAMNMLVRRA
KSKRALNSGQ