Protein Info for BPHYT_RS22160 in Burkholderia phytofirmans PsJN

Annotation: FKBP-type peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00254: FKBP_C" amino acids 43 to 129 (87 residues), 101.7 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: K03772, FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC: 5.2.1.8] (inferred from 91% identity to bge:BC1002_4465)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE49 at UniProt or InterPro

Protein Sequence (133 amino acids)

>BPHYT_RS22160 FKBP-type peptidylprolyl isomerase (Burkholderia phytofirmans PsJN)
MKSIVALVAAALLSSTAMAAAPTTEKLPSGVVVEHLTQGTGAQPAAEDVVKVNYRGTLAN
GTEFDSSAKHGGPATFPLNRVIPCWTQGVQKMKVGGKAKLTCPAATAYGDRGVGVIPPNS
DLTFEVELVGIVK