Protein Info for BPHYT_RS22150 in Burkholderia phytofirmans PsJN

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 881 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 66 to 876 (811 residues), 1125.2 bits, see alignment E=0 PF00270: DEAD" amino acids 80 to 258 (179 residues), 86.5 bits, see alignment E=4.3e-28 PF04851: ResIII" amino acids 82 to 256 (175 residues), 27.2 bits, see alignment E=8.3e-10 PF00271: Helicase_C" amino acids 319 to 417 (99 residues), 51.4 bits, see alignment E=2.9e-17 PF19306: Lhr_WH" amino acids 458 to 603 (146 residues), 194.9 bits, see alignment E=1.6e-61 PF08494: DEAD_assoc" amino acids 661 to 847 (187 residues), 175.3 bits, see alignment E=3.3e-55

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 100% identity to bpy:Bphyt_4460)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE44 at UniProt or InterPro

Protein Sequence (881 amino acids)

>BPHYT_RS22150 DEAD/DEAH box helicase (Burkholderia phytofirmans PsJN)
MTEPADSDETTIPAPSAASERRRAPRPRRIPRSREQQARLDAREPAFEPQPFSIDENAAQ
RPFAEKLGEWFEARRWQPFEFQREVWQEIARGASGLLHATTGAGKTWAVWFGALAAFAAT
PSARKRSTLRTQPEPLTVLWITPMRALAADTARALQSSAAELAVPWSVGLRTGDTSSAER
ARQNRRMPSALVTTPESLSLILTRPDAHDVLAHVRLVIVDEWHELLGNKRGTQTQLALAR
LAHWRPELQVWGLSATLGNLSFAGDVLLAPVKTPRVSVHGALPKALIVDTVIPETIERFP
WGGHVGMRQVGAVAEAIGEAQTSLVFTNTRSQCEVWYQALLEARPEWAGLIALHHGSLDQ
EVREWVERGLKSGLLKVVVCTSSLDLGVDFLPVERVFQIGSPKGVARLMQRAGRSGHAPG
RPSRVTIVPTHALELVEAAAAREAVEKRQIEGRETPEKPFDVLVQHLVTVAIGGGFDARE
LYGEIRSTYAYRQLTQAEFDWALGFVEGGGTALRAYPDYHRVVRESDGMYHVPREDLVRR
HRNNIGTIVANGTLNVAYLSGGRIGAIEESFISRLKPGDIFTFGGRALELIRVQDMTAWV
RRATSSRGAMPQWAGSRMPLSSELADATLTMLARAATGIYDEPEMRAVRPLLELQQKWSA
LPEPGVLVVELVKSREGHHFFCYPFAGRTAHIGLGALLAWRVAREKPGTFSISMNDYGFE
LLSAQPFDWAAQLESGLLSPKELDHDILASLNSSELSLRRFREIARVSGLVFQGHPGQQK
SARQLQASSALFYEIFRNHDRGNLLLNQADDEVLLQELDARRIRIALERMNASRVVVTRP
KKPTPFAFPLIVGRLREKVSTEKLADRVERMLAELEKAARV