Protein Info for BPHYT_RS22040 in Burkholderia phytofirmans PsJN

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 217 to 248 (32 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details PF12911: OppC_N" amino acids 27 to 78 (52 residues), 45.9 bits, see alignment 4.1e-16 PF00528: BPD_transp_1" amino acids 121 to 302 (182 residues), 98.9 bits, see alignment E=3.1e-32

Best Hits

Swiss-Prot: 52% identical to OPPC_HAEIN: Oligopeptide transport system permease protein OppC (oppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to bpy:Bphyt_4436)

MetaCyc: 35% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFD8 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BPHYT_RS22040 peptide ABC transporter permease (Burkholderia phytofirmans PsJN)
MPRSIQSTAAALDPLAAIARAPRSRGPLATAAWRFVRNRAAFAGFVVLMLIVIACVAGPW
LLPNNPIDSDWSAISLPPTLQNMHWFGTDELGRDLLARTLQGGRVSLEVGLLGTLVSGLI
GVAYGATAGYLGGRVDAVMMRIVDMMYAIPYMLIAILMMTMFGRAFYLVVLTISAFSWLD
MARVVRGQTLSLRSREFIDAARAIGVSSGSIIARHIVPNLFGVVVVYASVTVPNIVLTES
VLSFLGLGVQEPMTSWGVLIQDGAQKLESMPWLLLCPAVMLCVTLYCVNFVGDGLRDAFD
PKDR