Protein Info for BPHYT_RS22015 in Burkholderia phytofirmans PsJN

Annotation: spermidine/putrescine ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 161 (142 residues), 129.9 bits, E=1.1e-41
• PF08402: TOBE_2
  • amino acids 284 to 355 (72 residues), 51.1 bits, E=1.2e-17

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_4431)

MetaCyc: 43% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"ABC-type spermidine/putrescine transport systems, ATPase components"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

See B2TFD6 at UniProt or InterPro

Protein Sequence (363 amino acids)

>BPHYT_RS22015 spermidine/putrescine ABC transporter ATPase (Burkholderia phytofirmans PsJN)
MSFLTLTDVTKSFGDLQAVADVNLSVEKGEFVSLLGPSGCGKTTTLQMIAGFVETTHGRI
TLDGRDITHMKPNKRGLGIVFQSYALFPHMSVADNVGFGLEMRNIDKAERKERIREALSL
VRLDTLAHRFPRELSGGQRQRVALARAIVIAPPVLLLDEPMSNLDAKLREDMQFELRGIQ
RKIGTTTIMVTHDQSEALSISDRVVVMEAGRITQIDTPYEAYERPENRFVSQFIGKANML
PGTVVARDGDAIRIDLGHDLAETGHTAQLPARERVVGVGDAVTLCIRPEKLRLCAPNAGR
VPATVTSRFFLGSQWLYRLDSRLGEVLVCCQNEGTEPLPEGATVGVDWNSEAIRFIQRDA
HHG