Protein Info for BPHYT_RS22010 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 27 to 54 (28 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_4430)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFD5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BPHYT_RS22010 ABC transporter permease (Burkholderia phytofirmans PsJN)
MASTLPAADNPDMKSGNVRRAPWHAFLPLWLMCAPAFLLFVALVLVPLLMTLVLTFYRFD
PASGPIAAFQFGNYAEVLSSSYYHTIFLRTFGIAFLVTLLCIVIGTPEAYVLSRMRDPYR
SMFLLVILAPLLVSVVVRAFGWSMLLNTNGLVNQAFGLVGLGPYKLEYTTFAIVIALVHV
MLPFMVIPVWTALQKLDPQTENAALSLMASPATTLRRIVLPQLTPGILSGSLMVFGLSAS
AFAIPGLLGGRRLKVAATAVYDEFLGSLNWPLGATIALLLLVANLIVMLTYYRVLERKYT
RSLG