Protein Info for BPHYT_RS21975 in Burkholderia phytofirmans PsJN

Annotation: 2-dehydropantoate 2-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00745: 2-dehydropantoate 2-reductase" amino acids 2 to 281 (280 residues), 193.3 bits, see alignment E=2.9e-61 PF02558: ApbA" amino acids 3 to 151 (149 residues), 139.5 bits, see alignment E=6.7e-45 PF08546: ApbA_C" amino acids 178 to 282 (105 residues), 70.8 bits, see alignment E=1.4e-23

Best Hits

Swiss-Prot: 41% identical to YKPB_BACSU: Uncharacterized oxidoreductase YkpB (ykpB) from Bacillus subtilis (strain 168)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 100% identity to bpy:Bphyt_4423)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFC8 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BPHYT_RS21975 2-dehydropantoate 2-reductase (Burkholderia phytofirmans PsJN)
MRILVVGAGAVGGYFGGRLAAAGQDVTFLVRPGRAEKLKRDGLVISSVRGDLKLPDPQTI
LAGVSAEPFDLVLLSCKAFSLDDAIDSFAPLVGESTLILPMLNGMRHMEVLNEKFGAARV
LGGQCVIAATLNAEQHIVHLNDTHAITFGEQAGGASERVQAIAEAMGDANFDAVISDNIL
LRMWEKWVFLATLAGGTCLMRGSVGDILAAPDGKRVIENLLGECRAVAEHNGFTMGPDFD
ARATQTLFTPSPLTASMLRDVENHSHTEADHILGDLISRGGDAQKGEHGLSLLRIAYSHL
KTYEARQARTS