Protein Info for BPHYT_RS21965 in Burkholderia phytofirmans PsJN

Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 3 to 101 (99 residues), 68 bits, E=5.8e-23
• PF08211: dCMP_cyt_deam_2
  • amino acids 4 to 78 (75 residues), 36.9 bits, E=4.2e-13
• TIGR01354: cytidine deaminase
  • amino acids 5 to 127 (123 residues), 133.6 bits, E=2.3e-43

Best Hits

Swiss-Prot: 57% identical to CDD_BACSU: Cytidine deaminase (cdd) from Bacillus subtilis (strain 168)

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 100% identity to bpy:Bphyt_4421)

MetaCyc: 57% identical to cytidine/deoxycytidine deaminase monomer (Bacillus subtilis subtilis 168)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides degradation (4/5 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• pyrimidine ribonucleosides degradation (1/2 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)
• pyrimidine deoxyribonucleosides degradation (1/3 steps found)
• pyrimidine ribonucleosides salvage I (1/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (3/6 steps found)
• pyrimidine deoxyribonucleosides salvage (2/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

See B2TFC6 at UniProt or InterPro

Protein Sequence (129 amino acids)

>BPHYT_RS21965 cytidine deaminase (Burkholderia phytofirmans PsJN)
MNMEQLLERAGVAREKAYAPYSKFKVGAALLTKDGQVFDGCNVENASYGLCNCAERTAFF
SAIAAGYQRDQFAALAVIGDTDGPIAPCGACRQVIIELGGPELPIRLGNLHGATRDTTAR
EQLPDAFYL