Protein Info for BPHYT_RS21960 in Burkholderia phytofirmans PsJN

Annotation: nucleoside transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 124 to 154 (31 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 259 to 285 (27 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 362 to 388 (27 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details TIGR00804: nucleoside transporter, NupC family" amino acids 7 to 421 (415 residues), 467.4 bits, see alignment E=2.2e-144 PF01773: Nucleos_tra2_N" amino acids 9 to 82 (74 residues), 85.7 bits, see alignment E=3.7e-28 PF07670: Gate" amino acids 100 to 196 (97 residues), 58.8 bits, see alignment E=9.9e-20 PF07662: Nucleos_tra2_C" amino acids 202 to 419 (218 residues), 251 bits, see alignment E=1.4e-78

Best Hits

Swiss-Prot: 56% identical to NUPX_ECOLI: Putative nucleoside permease NupX (nupX) from Escherichia coli (strain K12)

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 100% identity to bpy:Bphyt_4420)

MetaCyc: 56% identical to putative nucleoside transporter (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nucleoside permease NupC" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFC5 at UniProt or InterPro

Protein Sequence (425 amino acids)

>BPHYT_RS21960 nucleoside transporter (Burkholderia phytofirmans PsJN)
MALIVRNILGIAVLLLIAFIFSTNRRAIRLRTVISALLVQIGIGAFILFVPFGKSILSGA
ASAVNHVLGYGNAGIEFLFGGLVQAKMFQVFGDGGFVFAVRVLPAIIFVTALISVLYYLG
VMRWIVIVLGTVFQKLLGVSKIESFSAVTTIFLGQSEMPAVVKPFTAEMTGAELFAVMSS
GMAAVAGSVLAGYAGLGVRIEYLLAASFMAVPGGLLFAKIIHPSTEPSRVHLENLNFDEK
RPANIIEAASSGATVGLKIAVMVGAMLIAFVGLIALLNGIVGGVGGWFGHPQLSMQSVLG
VIFAPLAYLIGVPWNEATIAGNFLGQKVILNEFVAYASLSPYLKDAASVSAAGLAALDPR
TIAILSFALCGFANFSSIAVLTGGFSAVAPARRAEVARYGLRVVLAATLSNLMSATIAGM
FITLN